spacer

EBI Dbfetch

ID   AF148518; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF148518;
XX
DT   07-MAY-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen (HLA) gene, HLA-DRB3*0209 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2000.560113.x.
RX   PUBMED; 10958362.
RA   Morabito A., Pera C., Longo A., Delfino L., Ferrara G.B.;
RT   "Identification of a new DRB3*02 allelic variant (DRB3*0209) by
RT   high-resolution sequence-based typing";
RL   Tissue Antigens 56(1):90-94(2000).
XX
RN   [2]
RP   1-270
RA   Morabito A., Longo A., Pera C., Delfino L., Ferrara G.B.;
RT   ;
RL   Submitted (05-MAY-1999) to the INSDC.
RL   Immunogenetics, National Cancer Institute, L.go R. Benzi, n.10, Genova
RL   16132, Italy
XX
DR   MD5; 0363acc40c7ac7726945ed93f7cbb056.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte from peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAF67837.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 65 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer