spacer

EBI Dbfetch

ID   AH007763; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH007763; AF147454-AF147455;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*1105 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2000.550412.x.
RX   PUBMED; 10852390.
RA   Ellis J., Steiner N., Kosman C., Henson V., Mitton W., Koester R., Ng J.,
RA   Hartzman R.J., Hurley C.K.;
RT   "Seventeen more novel HLA-A locus alleles";
RL   Tissue Antigens 55(4):369-373(2000).
XX
RN   [2]
RP   1-646
RA   Ellis J.M., Hurley C.K.;
RT   ;
RL   Submitted (06-APR-1999) to the INSDC.
RL   Microbiology, Georgetown University Medical Center, Research Building E404,
RL   3970 Reservoir Road NW, Washington, DC 20007, USA
XX
DR   MD5; ae40bfb3dd949aad20c2d21f858cc3df.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:4929430, gi:4929431, gi:4929432.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="9292"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1105"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1105"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1105"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="AAD33991.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITERKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1105"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1105"
FT                   /number=3
XX
SQ   Sequence 646 BP; 109 A; 164 C; 199 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccga gcgcaagtgg       540
     gaggcggccc atgcggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer