Dbfetch

ID   AF144081; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AF144081;
XX
DT   07-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1102 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   "Human Leukocyte Class II Antigen";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   ;
RL   Submitted (19-APR-1999) to the INSDC.
RL   Microbiology and Immunology, Georgetown University, 3970 Reservoir Rd. NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; 1560f6563e938142265234eb0761316b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*0103,11new; DRB3*0301"
FT                   /tissue_type="blood"
FT                   /note="isolated from people of African American origin"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>269
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..269
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="leukocyte antigen class II"
FT                   /db_xref="GOA:Q9TPE1"
FT                   /db_xref="IMGT/HLA:DRB1*11:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TPE1"
FT                   /protein_id="AAD53054.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDLLEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 269 BP; 58 A; 63 C; 96 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcga                                         269
//