spacer

EBI Dbfetch

ID   AF141221; SV 1; linear; genomic DNA; STD; ROD; 1123 BP.
XX
AC   AF141221;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Millardia meltada country India cytochrome b (cytb) gene, partial cds;
DE   mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Millardia meltada (soft-furred rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Millardia.
OG   Mitochondrion
XX
RN   [1]
RP   1-1123
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1123
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; a329ee4fabf65e0576d19a72fd75e952.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1123
FT                   /organism="Millardia meltada"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="India"
FT                   /db_xref="taxon:121583"
FT   mRNA            <1..>1123
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1123
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPB2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPB2"
FT                   /protein_id="AAF65610.1"
FT                   /translation="MTNIRKTHPLMKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGIYY
FT                   GSYTFLETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDLLGVFIMLLFLFILVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILVLALLPFLHTSKQRSLMFRPITQFLYWVLVANLLVLTWIGG
FT                   QPVEHPFIIIGQVASISYFSIILILMPIAGIIED"
XX
SQ   Sequence 1123 BP; 354 A; 287 C; 141 G; 339 T; 2 other;
     atgacaaaca tccgaaaaac ccacccacta ataaaaatta ttaaccactc attcatcgat        60
     ctacccgccc catcaaacat ctcatcatga tgaaattttg gctcccttct aggtatttgc       120
     ctaataatcc aaatcattac tggactattc ctagccatac attatacatc agacacaaca       180
     acagcattct catcagttac ccatatctgc cgagatgtaa actacggatg actaattcga       240
     tatatacacg ccaacggagc ctcaatattc tttatctgcc ttttcctaca cgtaggacga       300
     ggaatttatt atggatcata tacttttcta gaaacatgaa atattggagt gcttttactg       360
     tttgcagtaa tagccactgc atttataggt tatgtcctcc catgaggaca aatatcattc       420
     tgaggagcaa cagtaattac taatttactc tcagctatcc cttatatcgg nacaactcta       480
     gtagaatgaa tttgaggtgg attctctgta gacaaagcca ccctaacacg attcttcgca       540
     tttcacttca ttttaccctt catcattgca gccctagcaa ttgtacatct attattccta       600
     catgaaacag gttctaacaa tcctacagga ctaaactcag acgcagacaa aatcccattt       660
     cacccatatt atacaattaa agatctatta ggagtattta ttatactcct attcttattt       720
     atcttagtat tatttgcccc agacctacta ggagacccag acaattatac acctgctaac       780
     cctcttaaca caccaccaca cattaaacca gaatgatact tcctatttgc ctacgctatc       840
     ctccgatcta ttcctaacaa actaggagga gtattagccc taattctatc tatcttagta       900
     ctagccctac tcccntttct tcacacctct aaacaacgaa gcctaatatt tcgcccaatt       960
     acacaattcc tgtactgagt cctagtagct aacctactag tattaacctg aattggagga      1020
     caacccgtag agcacccatt catcattatt ggccaagtag cctcaattag ttacttctcc      1080
     attatcttaa tcttgatacc aattgcagga atcatcgaag aca                        1123
//


spacer
spacer