spacer

EBI Dbfetch

ID   AF141218; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141218;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Grammomys sp. Berega country Tanzania cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Grammomys sp. Berega
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Grammomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 26067dc776bd980fef557f7632fc91fc.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Grammomys sp. Berega"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Tanzania: Berega"
FT                   /db_xref="taxon:122201"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPB5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPB5"
FT                   /protein_id="AAF65607.1"
FT                   /translation="MTNTRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMVQI
FT                   ITGLFLAMHYTSDTTTAFSSVAHICRDVNYGWFIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVLLLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAMVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGALIMITLLMILVLFFPDLLGDPDNYTYTNPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALIMSILILGLLPFLHTSKQRSMMFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFTIILILMPISGIIEDNLLKWS"
XX
SQ   Sequence 1140 BP; 367 A; 315 C; 136 G; 322 T; 0 other;
     atgacaaaca cccgaaaaac acatccatta cttaaaatta tcaaccactc attcattgac        60
     ctacctgccc catccaacat ctcatcatga tgaaactttg gctccctact aggaatctgc       120
     ttaatagtac aaattattac aggcctattt ttagctatac attacacatc agacacaaca       180
     acagcatttt catcagtagc tcatatctgt cgagacgtaa actacggctg attcatccga       240
     tatatacatg caaacggagc ctcaatattc ttcatctgcc tattccttca cgtaggccga       300
     ggcatatact atggatccta tacattccta gagacatgaa acattggagt actactatta       360
     tttacagtca tagccactgc attcatagga tatgtcctcc catgaggaca aatatcattc       420
     tgaggagcta cagtaattac caacctactc tcagccatcc catacatcgg aacaacccta       480
     gtagaatgaa tctgaggtgg cttctcagta gacaaagcca ctctcactcg attcttcgca       540
     tttcacttta ttttaccctt catcatcgca gcccttgcaa tagtccattt actattccta       600
     catgaaacag gctctaataa ccccacagga ttaaactcag actcagacaa aattccattc       660
     cacccatact acactattaa agatatctta ggagccttaa tcataatcac cctactaata       720
     attctagtat tattcttccc tgacctccta ggagacccag acaattatac atacaccaac       780
     ccacttaaca ccccacccca tattaaacca gagtgatact ttctatttgc ctatgccatc       840
     ctacgatcta tccccaacaa actaggaggc gtgttagcct taatcatatc aatcctaatc       900
     ctaggccttc ttcccttcct tcatacctca aaacaacgaa gcataatatt tcgtccaatc       960
     acccaaaccc tatactgaat tctagtcgca aatctactaa tcctaacctg aattggagga      1020
     caacctgtag aacacccatt cattattatt ggacaactag cttccatcag ctactttact      1080
     attattctaa tcctgatacc aatctcaggt attatcgaag ataacctact aaaatgaagc      1140
//


spacer
spacer