spacer

EBI Dbfetch

ID   AF141217; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141217;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Dasymys incomtus country Tanzania cytochrome b (cytb) gene, partial cds;
DE   mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Dasymys incomtus (African marsh rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Dasymys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 1df5a5d55b236799ae19ffbcc27a447e.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Dasymys incomtus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Tanzania: Berega"
FT                   /db_xref="taxon:71173"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPB6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPB6"
FT                   /protein_id="AAF65606.1"
FT                   /translation="MTNIRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLTIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLVRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVLIMFLTLMILVLFFPDMLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPFLHTSKQRSLIFRPITQTLYWILAANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 351 A; 340 C; 139 G; 310 T; 0 other;
     atgacaaaca tccgaaaaac tcacccctta tttaaaatta tcaaccactc cttcattgac        60
     ctccctgccc catccaacat ctcctcatga tgaaactttg gctccctgtt aggaatctgc       120
     ttaactatcc aaattatcac aggcctattt ctagctatac actacacatc agatacaata       180
     acagccttct catcagtaac ccatatctgc cgagacgtaa attacggatg actagtacga       240
     tatatacacg ctaacggagc ctcaatattt tttatctgct tatttctcca cgtaggacgg       300
     gggatatact acggatccta tacgttccta gaaacatgaa acatcggagt actcctccta       360
     ttcgcagtca tagccactgc attcataggc tacgtcctac catgaggaca aatatcattc       420
     tgaggagcaa cagtaatcac aaacctactt tcagctatcc catacatcgg cactacccta       480
     gtagaatgaa tctgaggcgg cttctcagta gacaaagcca ccctaactcg attcttcgca       540
     ttccacttca tccttccatt catcattaca gcccttgtaa ttgtccatct cctattcctc       600
     cacgaaacag gctcaaacaa cccaacaggc ctaaattcag acgcagataa aattccattc       660
     cacccttact ataccattaa agacatccta ggagtcctca tcatattcct aacactaata       720
     attctagtcc tattcttccc tgatatacta ggagacccag acaactatac accagctaac       780
     cctctcaata ctccccctca catcaaacca gaatgatatt ttctatttgc ctacgctatc       840
     ctacgctcaa tccccaataa acttggaggg gttctagccc taatcctttc aattcttatc       900
     ctggccttcc tacccttcct acacacttca aaacaacgaa gcctaatttt tcgcccaatc       960
     acccaaacac tatactgaat cctagcagca aacctacttg tactaacctg aattggaggc      1020
     cagcccgtag aacacccctt catcattatt ggccaattag cctcaatcag ttacttctcc      1080
     atcattctaa tcctaatacc aatctcaggc attatcgaag acaaaatatt aaaatgaaac      1140
//


spacer
spacer