spacer

EBI Dbfetch

ID   AF141215; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141215;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Aethomys namaquensis country South Africa cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Micaelamys namaquensis (Namaqua Micaelamys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Micaelamys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 3f55b38426765c81d432eb6bad721758.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Micaelamys namaquensis"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa: Itala"
FT                   /db_xref="taxon:472707"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPB8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPB8"
FT                   /protein_id="AAF65604.1"
FT                   /translation="MTNIRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLMVQI
FT                   LTGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLVRYMHANGASMFFICLFMHVGRGMYY
FT                   GSYTFLETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGMLIMLVLLMILVLFFPDSLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALIMSILILVFLPYLHTSKQRSLMFRPITQMLYWLLVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPIAGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 368 A; 290 C; 140 G; 342 T; 0 other;
     atgacaaaca tccgaaaaac ccatccccta ttcaaaatta ttaatcactc attcattgac        60
     cttccagccc catccaacat ctcatcatga tgaaacttcg gttcacttct tggaatctgc       120
     ttaatagtcc aaattttaac tggcttattc ttagctatac actacacctc cgacacacta       180
     acagcattct catcagtaac ccacatctgt cgagacgtta attacggctg attggtacga       240
     tatatacacg caaatggagc ctcaatattc ttcatctgcc tatttataca cgtaggacga       300
     ggtatatact acggatcata cacattttta gaaacatgaa acatcggggt aattctttta       360
     tttacagtaa tagctaccgc atttataggt tatgtactcc catgaggaca aatatcattt       420
     tgaggggcaa cagtaattac aaacttacta tctgccattc catacattgg aactacttta       480
     gtagaatgaa tctgaggagg attctcagta gataaagcca ccctaacccg attcttcgca       540
     tttcacttca ttttaccatt catcattaca gccctcgtaa ttgttcacct cttattcctg       600
     cacgaaacag gctccaacaa cccaacagga ctaaattcag acgcagacaa aattccattt       660
     catccatatt ataccatcaa agacattcta gggatattaa ttatactagt actcctaata       720
     attctagtct tattctttcc agactcatta ggagacccag acaactatat accagccaac       780
     ccacttaaca cccccccaca tatcaaacca gaatgatact tcctatttgc ctacgctatt       840
     ctacggtcca tccctaataa actaggaggg gtactagctc taattatatc cattctaatc       900
     ctagtttttt taccttacct tcatacctca aaacaacgca gtctaatatt ccggccaatt       960
     actcaaatat tatactgact attagtagca aacttactaa ttctaacctg aatcggaggt      1020
     caacctgtag aacacccatt tattatcatt ggtcaactag cctctatcag ctatttctcc      1080
     attattctaa tcctcatacc aattgcaggc atcatcgaag acaaaatact aaaatgaaac      1140
//


spacer
spacer