spacer

EBI Dbfetch

ID   AF141214; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141214;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Rhabdomys pumilio country South Africa cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Rhabdomys pumilio (four-striped grass mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rhabdomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 5838a2603b2ae63ea38bd8b0eb928eea.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Rhabdomys pumilio"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa: Willem Prinsloo"
FT                   /db_xref="taxon:121573"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPB9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPB9"
FT                   /protein_id="AAF65603.1"
FT                   /translation="MTNIRKSHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLILQI
FT                   LTGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVALLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   TWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLDSDADKIPFHP
FT                   YYTIKDLLGILMMIIFLMTLVLFFPDLLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLMFRPITQTLYWMLVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIQNKLLKWT"
XX
SQ   Sequence 1140 BP; 339 A; 314 C; 142 G; 345 T; 0 other;
     atgacaaaca tccgaaaatc tcaccctcta cttaaaatta ttaatcactc atttattgat        60
     ctccctgctc cctctaacat ttcatcatga tggaacttcg gctctctact aggaatctgc       120
     ctaatcctac aaatccttac agggctcttc ctagccatac actacacatc cgatacaata       180
     acagccttct cttcagtcac ccatatttgc cgagacgtaa actacggctg actaatccga       240
     tatatacatg caaacggagc atcaatattt ttcatctgct tattcctcca tgtaggccga       300
     ggcatatatt atgggtccta tacattttta gagacatgaa atattggagt agccctacta       360
     ttcgcagtta tagctacggc attcatgggc tatgtacttc catgaggcca aatatcattc       420
     tgaggggcaa cagtaattac aaacttactt tcagcaattc catatattgg taccactcta       480
     gtagaatgaa cctgaggcgg attctcagta gataaagcta ctttaactcg atttttcgca       540
     tttcatttca tcctgccatt catcatcgca gcccttgtaa ttgttcacct cttattcctt       600
     catgaaacag ggtctaacaa ccccacagga ttagactcag atgccgacaa aatccccttt       660
     catccttact acaccattaa agacctccta ggaatcctaa taataatcat tttcctaata       720
     acccttgtct tatttttccc agacttacta ggagaccctg acaactatat accagctaac       780
     cctctcaaca cccctcccca tattaaacca gaatgatatt tcctattcgc ctacgccatc       840
     cttcgctcta tcccaaataa attaggaggg gttctagcac taatcctatc aatcttaatt       900
     ctagccctac tcccctttct ccacacctca aaacaacgca gcctaatatt ccgccctatt       960
     acccaaactc tttattgaat actagtagca aacttactca tcctaacctg aattggaggt      1020
     cagcccgtag aacacccatt catcattatc ggccaattag cctctatcag ttacttttct      1080
     atcatcctaa tccttatgcc aatctcaggt ataattcaaa ataaattact aaaatgaact      1140
//


spacer
spacer