spacer

EBI Dbfetch

ID   AF141212; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141212;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mylomys dybowskii country Cote d'Ivoire cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Mylomys dybowskii (African groove-toothed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mylomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 1808cfaf4b446e78eeb15045eb0a87fb.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC3815218; 24223730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Mylomys dybowskii"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Cote d'Ivoire: Lamto"
FT                   /db_xref="taxon:121581"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPC1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPC1"
FT                   /protein_id="AAF65601.1"
FT                   /translation="MTNIRKTHPLMKIINHSFIDLPAPSNISSWWNFGSLLGICLMLQI
FT                   VTGLFLAMHYTSDTMTAFSSVTHICRDCNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSCTFLETWNIGVLLLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTALVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVLMMITFLMVLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGDVLALILSILVLAFLPYIHTSKQRSLIFRPITQTLYWMLVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIEDKLLKWN"
XX
SQ   Sequence 1140 BP; 348 A; 324 C; 148 G; 320 T; 0 other;
     atgacaaaca tccgaaaaac tcacccacta ataaaaatca tcaaccactc attcattgat        60
     ctcccagccc cctctaatat ttcgtcgtga tgaaattttg gctccttact agggatctgt       120
     ctcatactac aaattgttac aggactattc ctagccatac attacacatc agatacaata       180
     acagcattct catcagttac acatatctgc cgagactgca attatggatg attaattcga       240
     tatatacacg caaacggagc ctcaatattc tttatttgct tgtttcttca cgtaggacga       300
     ggaatatatt atgggtcctg cacattccta gaaacatgga atatcggtgt gctactatta       360
     ttcaccgtca tagccaccgc attcataggt tacgtccttc catggggaca aatatcattc       420
     tgaggcgcaa cagtaattac gaatctactc tcagccatcc catacattgg cactgcccta       480
     gtagaatgaa tttgaggcgg attctccgta gacaaagcta ctttaacccg tttcttcgca       540
     tttcacttca tccttccatt tatcatcgca gccctcgtca ttgtccacct cctattcctt       600
     catgaaacag gctcaaacaa ccccacaggc ctaaactcag atgcagataa aatcccattc       660
     cacccatatt acactattaa agatatcctg ggggtattaa taataatcac atttctaata       720
     gtcctagtat tatttttccc agacttacta ggagaccccg ataactacac accagctaac       780
     ccactaaaca ctcccccaca catcaaacca gaatgatatt tcctattcgc ctacgccatt       840
     ctccgctcca tccctaataa actaggagac gtcctagccc taattctatc aatcctagta       900
     ctagcattcc taccctacat tcacacttct aaacaacgaa gcctaatttt ccgcccaatc       960
     actcaaaccc tctactgaat attagtcgcc aacctactag tcctaacctg aattggaggt      1020
     caaccagtag agcacccctt cattatcatc ggtcagctag cctccatcag ctacttctcc      1080
     attatcctca ttcttatacc aatctcagga ataatcgaag acaaactact aaaatgaaac      1140
//


spacer
spacer