spacer

EBI Dbfetch

ID   AF141210; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141210;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Lemniscomys striatus country Republic of the Congo cytochrome b (cytb)
DE   gene, partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Lemniscomys striatus (typical striped grass mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Lemniscomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 27d729e96c183d06e2d371b91363d664.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Lemniscomys striatus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Republic of the Congo: Tchissanga"
FT                   /db_xref="taxon:121567"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPC3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPC3"
FT                   /protein_id="AAF65599.1"
FT                   /translation="MTNIRKTHPLFKIINHTFIDLPAPSNISSWWNFGSLLGVCLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVAHICRDVNYGWLVRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFIFPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGILIMIVFLMILVLFFPDLLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPFLHTSKQRSLTFRPITQILYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIEDNMLKWS"
XX
SQ   Sequence 1140 BP; 357 A; 275 C; 135 G; 373 T; 0 other;
     atgacaaaca tccgaaaaac ccacccttta tttaaaatta ttaatcatac attcattgat        60
     ctccccgctc catctaatat ctcatcatga tgaaatttcg gctccttatt aggagtatgc       120
     ttaataatcc aaattattac aggtctattt ctagctatac actacacatc agatacaaca       180
     acagcatttt catcagtagc acatatctgc cgagacgtaa actacggctg actagttcga       240
     tatatacacg caaacggagc ctcaatattc ttcatctgcc tatttcttca cgtaggacga       300
     gggatatact atggatctta cacattccta gaaacatgaa atattggtgt tattctatta       360
     tttacagtaa tagccacagc attcataggc tatgtccttc catgagggca aatatcattc       420
     tgaggagcaa cagtaattac aaatctacta tcagctatcc catacattgg caccacccta       480
     gtagaatgaa tttgaggtgg attctcagta gacaaagcta ccctaactcg ttttttcgca       540
     tttcatttta ttttcccatt catcattaca gcccttgtaa ttgttcacct tctatttcta       600
     catgaaacag gctcaaacaa cccaacaggt ttaaattcag atgcagataa aattccattt       660
     catccatact ataccattaa agacattcta ggaattctca ttataattgt atttctaata       720
     attctagtcc tattcttccc agacttacta ggagatcctg ataattatat accagctaac       780
     ccacttaaca cccctcctca tattaaacca gaatgatatt ttctatttgc ctatgctatc       840
     ctacgctcta ttcctaataa acttggaggt gtcttagctc taattctatc tattctaatt       900
     ctagcctttc taccatttct ccatacttct aaacaacgta gcttaacatt ccgcccaatt       960
     acccaaatcc tatactgaat tctagtagcc aacctactta ttctaacctg aatcggaggt      1020
     caacctgtcg aacatccctt tatcattatt ggacaactag cctccattag ctacttttct      1080
     attattctca tccttatacc tatctcagga ataatcgaag ataacatact aaaatgaagc      1140
//


spacer
spacer