spacer

EBI Dbfetch

ID   AF141206; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF141206;
XX
DT   27-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Desmomys harringtoni country Ethiopia cytochrome b (cytb) gene, partial
DE   cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Desmomys harringtoni (Harrington's rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Desmomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   "An assessment of the systematics of arvicanthine rodents using
RT   mitochondrial DNA sequences: evolutionary and biogeographical
RT   implications";
RL   J. Mammal. Evol. 8(3):173-206(2001).
XX
RN   [2]
RP   1-1140
RA   Ducroz J.F., Volobouev V., Granjon L.;
RT   ;
RL   Submitted (07-APR-1999) to the INSDC.
RL   Laboratoire Mammiferes et Oiseaux, Museum National d'Histoire Naturelle, 55
RL   rue Buffon, Paris 75005, France
XX
DR   MD5; 650f498bc4b3fcba6f67888c9c70e438.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC3815218; 24223730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Desmomys harringtoni"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Ethiopia: Addis Ababa"
FT                   /db_xref="taxon:121587"
FT   mRNA            <1..>1140
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9MPC7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MPC7"
FT                   /protein_id="AAF65595.1"
FT                   /translation="MTNIRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGLCLMIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVALLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDLLGILMLVVFLMALVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLIFRPITQTLYWMLVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGMIEDKMLKWS"
XX
SQ   Sequence 1140 BP; 341 A; 331 C; 147 G; 321 T; 0 other;
     atgacaaata tccgaaaaac ccacccatta cttaaaatta tcaaccactc attcattgac        60
     cttccagccc catccaacat ctcatcctga tgaaacttcg gctccctact aggactctgc       120
     ctaataatcc aaatcattac tggcctattc ctagccatac attatacatc agatacaata       180
     acagcattct catcagtaac acacatttgc cgagatgtaa attacggctg acttattcga       240
     tatatgcatg ctaacggagc ctcaatattt tttatctgcc tattccttca cgtaggccga       300
     ggcatgtact acggatccta tacatttcta gaaacatgga acattggagt agccctccta       360
     tttgcagtca tagctaccgc attcatgggt tatgtccttc catgaggaca aatatccttc       420
     tgaggagcaa cagtaattac taacctacta tcagcaattc catatatcgg caccacactc       480
     gtagaatgaa tttgaggtgg attctcagta gacaaggcca ctttaacccg tttcttcgca       540
     ttccatttca ttttaccatt tattattgca gctctcgtca tcgttcacct tctattccta       600
     cacgaaacag gatcaaacaa ccctacgggc ctaaactcag acgcagacaa aatccccttc       660
     cacccatatt atactatcaa agaccttcta ggtatcctaa tactagtagt attcttaata       720
     gcccttgtac tattctcccc agacctgtta ggagaccctg acaactatac accagccaac       780
     ccacttaaca cccctcctca catcaagcca gagtgatact tcctatttgc ctacgccatc       840
     cttcgctcca ttcctaacaa actaggaggt gtcctagccc tgattctttc catcctaatc       900
     ctagccctcc tacccttcct tcacacctca aaacaacgaa gcctaatctt ccgaccaatt       960
     acccaaacac tatattgaat gctagtagcc aacctgctta tcctaacttg aattggagga      1020
     caacccgtag aacacccatt cattatcatt ggccaactag cctccatcag ctatttctcc      1080
     atcattctaa ttcttatacc aatttcaggc ataattgaag acaaaatact aaaatgaagc      1140
//


spacer
spacer