spacer

EBI Dbfetch

ID   AF132810; SV 1; linear; genomic DNA; STD; HUM; 257 BP.
XX
AC   AF132810;
XX
DT   17-MAY-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB3 gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-257
RA   Carcassi C., Lai S., Alba F.;
RT   "Homo sapiens MHC class II HLA-DRB3, exon 2 new";
RL   Unpublished.
XX
RN   [2]
RP   1-257
RA   Carcassi C., Lai S., Alba F.;
RT   ;
RL   Submitted (03-MAR-1999) to the INSDC.
RL   Medical Genetics, University of Cagliari, Via S. Giorgio 12, Cagliari
RL   09124, Italy
XX
DR   MD5; e9b6e144f48178fe0667f10830b29b79.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..257
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="QC16/98"
FT                   /db_xref="taxon:9606"
FT   exon            1..>257
FT                   /number=2
FT   mRNA            <1..>257
FT                   /product="MHC class II antigen HLA-DRB3"
FT   CDS             <1..>257
FT                   /codon_start=3
FT                   /product="MHC class II antigen HLA-DRB3"
FT                   /db_xref="GOA:Q9TQP2"
FT                   /db_xref="IMGT/HLA:DRB3*02:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TQP2"
FT                   /protein_id="AAD30528.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVGESFT"
XX
SQ   Sequence 257 BP; 55 A; 62 C; 92 G; 48 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcaca                                                      257
//


spacer
spacer