spacer

EBI Dbfetch

ID   AH009682; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH009682; AF129291-AF129292;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B*4022N
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2000.550414.x.
RX   PUBMED; 10852392.
RA   Tamouza R., Sadki K., Schaeffer V., Carbonnelle E., Tatari Z., Chabod J.,
RA   Toubert A., Raffoux C., Sayada C., Charron D.;
RT   "A novel HLA-B null allele (B*4022N) generated by a nonsense codon in the
RT   alpha1 domain";
RL   Tissue Antigens 55(4):378-380(2000).
XX
RN   [2]
RP   1-646
RA   Tamouza R., Chabod J., Sadki K., Schaeffer V., Tiberghien P., Raffoux C.,
RA   Charron D.;
RT   ;
RL   Submitted (17-FEB-1999) to the INSDC.
RL   Immunology and Histocompatibility, St. Louis Hospital, 1, Avenue Claude
RL   Vellefaux, Paris 7510, France
XX
DR   MD5; f5165c0356894dfde809cf8a03123b7c.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:9695290, gi:9695291, gi:9695289.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /note="null allele"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /product="truncated MHC class I antigen"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /number=2
FT   CDS             <1..173
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /product="truncated MHC class I antigen"
FT                   /db_xref="GOA:Q9MY27"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY27"
FT                   /protein_id="AAF97413.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGP"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4022N"
FT                   /number=3
XX
SQ   Sequence 646 BP; 113 A; 172 C; 187 G; 74 T; 100 other;
     GCTCCCACTC CATGAGGTAT TTCCACACCG CCATGTCCCG GCCCGGCCGC GGGGAGCCCC        60
     GCTTCATCAC CGTGGGCTAC GTGGACGACA CGCTGTTCGT GAGGTTCGAC AGCGACGCCA       120
     CGAGTCCGAG GAAGGAGCCG CGGGCGCCAT GGATAGAGCA GGAGGGGCCT TAGTATTGGG       180
     ACCGGGAGAC ACAGATCTCC AAGACCAACA CACAGACTTA CCGAGAGAGC CTGCGGAACC       240
     TGCGCGGCTA CTACAACCAG AGCGAGGCCG NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       300
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       360
     NNNNNNNNNN GGTCTCACAC CCTCCAGAGG ATGTACGGCT GCGACGTGGG GCCGGACGGG       420
     CGCCTCCTCC GCGGGCATAA CCAGTACGCC TACGACGGCA AGGATTACAT CGCCCTGAAC       480
     GAGGACCTGC GCTCCTGGAC CGCCGCGGAC ACGGCGGCTC AGATCTCCCA GCGCAAGTTG       540
     GAGGCGGCCC GTGTGGCGGA GCAGCTGAGA GCCTACCTGG AGGGCGAGTG CGTGGAGTGG       600
     CTCCGCAGAT ACCTGGAGAA CGGGAAGGAC AAGCTGGAGC GCGCTG                      646
//



spacer
spacer