spacer

EBI Dbfetch

ID   AH009695; SV 2; linear; genomic DNA; STD; HUM; 819 BP.
XX
AC   AH009695; AF127806-AF127807; AF132491;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-819
RX   DOI; 10.1034/j.1399-0039.2002.590512.x.
RX   PUBMED; 12144629.
RA   Feldman D., Kearns J., Wu J., Bassinger S., Montoya G.D., McKeen M.,
RA   Birkos S., Williams T.M., Kamoun M.;
RT   "Identification and sequencing of HLA-B*0714 and B*2718 alleles and novel
RT   exon 1 sequences of B*0709 and B*2714 alleles in potential bone marrow
RT   donors";
RL   Tissue Antigens 59(5):426-429(2002).
XX
RN   [2]
RP   1-819
RA   Wu J., Kearns J., Kamoun M., Williams T.M.;
RT   "Novel HLA-B alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-819
RA   Wu J., Kearns J., Williams T.M., Kamoun M.;
RT   ;
RL   Submitted (11-FEB-1999) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino de Salud, NE, Albuquerque,
RL   NM 87131, USA
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:9738920, gi:9738921, gi:9738922, gi:9738919.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..819
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT   mRNA            join(<1..73,174..443,544..>819)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..>819)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q9GJN8"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJN8"
FT                   /protein_id="AAF97848.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07"
FT                   /number=3
XX
SQ   Sequence 819 BP; 119 A; 198 C; 218 G; 84 T; 200 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacagatc tacaaggccc aggcacagac tgaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggta tgaccagtac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagcgg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gacaagctgg agcgcgctg                              819
//


spacer
spacer