spacer

EBI Dbfetch

ID   AF121971; SV 1; linear; genomic DNA; STD; HUM; 253 BP.
XX
AC   AF121971;
XX
DT   09-APR-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 gene (HLA-DRB1*NK allele), exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-253
RA   Kennedy A., Greville W.D., Dunckley H.;
RT   "New HLA class II (DRB1) alleles detected by sequencing-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-253
RA   Kennedy A., Greville W.D., Dunckley H.;
RT   ;
RL   Submitted (21-JAN-1999) to the INSDC.
RL   Molecular Genetics, Australian Red Cross Blood Service, 153 Clarence
RL   Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 8a2e4b500f6219081fee9ff9e6928c12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..253
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>253
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..>253
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>253
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9TQ70"
FT                   /db_xref="IMGT/HLA:DRB1*08:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TQ70"
FT                   /protein_id="AAD24059.1"
FT                   /translation="FLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVT
FT                   ELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFT"
XX
SQ   Sequence 253 BP; 54 A; 58 C; 90 G; 51 T; 0 other;
     tttcttggag tactctacgg gtgagtgtta tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tagcgccgag tactggaaca gccagaagga       180
     cttcctggaa gacaggcggg ccctggtgga cacctactgc agacacaact acggggttgg       240
     tgagagcttc acg                                                          253
//


spacer
spacer