spacer

EBI Dbfetch

ID   AF112879; SV 1; linear; genomic DNA; STD; HUM; 259 BP.
XX
AC   AF112879;
XX
DT   11-MAY-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 gene (HLA-DRB1*1433 allele),
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-259
RA   Greville W.D., van Eijck A., Dunckley H.;
RT   "New HLA class II (DRB1) alleles detected by sequencing-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-259
RA   Greville W.D., van Eijck A., Dunckley H.;
RT   ;
RL   Submitted (11-DEC-1998) to the INSDC.
RL   Molecular Genetics, Australian Red Cross Blood Service, 153 Clarence
RL   Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 6b947978a2a9c21961705db92119e6bc.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..259
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="LAM"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>259
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..>259
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>259
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:33"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAD29584.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTE
FT                   LGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQR"
XX
SQ   Sequence 259 BP; 55 A; 62 C; 95 G; 47 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gacagatact tccataacca ggaggagaac gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gccgagtact ggaacagcca gaaggacctc       180
     ctggagcaga ggcgggccga ggtggacacc tactgcagac acaactacgg ggttgtggag       240
     agcttcacag tgcagcggc                                                    259
//


spacer
spacer