spacer

EBI Dbfetch

ID   AF110252; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF110252;
XX
DT   07-APR-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class I antigen HLA-B gene (HLA-B*15 allele), exon 3 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1034/j.1399-0039.2000.550510.x.
RX   PUBMED; 10885568.
RA   Williams T.M., Wu J., Bassinger S., Montoya G.D., Yee J., Griffith B.B.,
RA   Kearns J., McKeen M., Birkos S., Gourley I.S., Kamoun M.;
RT   "Novel HLA-B*15 alleles identified in potential marrow donors";
RL   Tissue Antigens 55(5):455-459(2000).
XX
RN   [2]
RP   1-276
RA   Wu J., Bassinger S., Montoya G.D., Yee J., Griffith B.B., Kearns J.,
RA   McKeen M., Birkos S., Kamoun M., Williams T.M.;
RT   ;
RL   Submitted (30-NOV-1998) to the INSDC.
RL   Pathology, Univ. New Mexico, 915 Camino de Salud, NE, Albuquerque, NM
RL   87131, USA
XX
DR   MD5; 9db540ae69583afc2841f8497a247cd2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(AF110250.1:<1..73,AF110251.1:1..270,1..>276)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(AF110250.1:1..73,AF110251.1:1..270,1..>276)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q9TQI8"
FT                   /db_xref="IMGT/HLA:B*15:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TQI8"
FT                   /protein_id="AAD23391.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 52 A; 85 C; 105 G; 34 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer