Dbfetch

ID   AH007555; SV 2; linear; genomic DNA; STD; HUM; 819 BP.
XX
AC   AH007555; AF110250-AF110252;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 6 MHC class I antigen (HLA-B) gene, HLA-B*15
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-819
RX   DOI; 10.1034/j.1399-0039.2000.550510.x.
RX   PUBMED; 10885568.
RA   Williams T.M., Wu J., Bassinger S., Montoya G.D., Yee J., Griffith B.B.,
RA   Kearns J., McKeen M., Birkos S., Gourley I.S., Kamoun M.;
RT   "Novel HLA-B*15 alleles identified in potential marrow donors";
RL   Tissue Antigens 55(5):455-459(2000).
XX
RN   [2]
RP   1-819
RA   Wu J., Bassinger S., Montoya G.D., Yee J., Griffith B.B., Kearns J.,
RA   McKeen M., Birkos S., Kamoun M., Williams T.M.;
RT   ;
RL   Submitted (30-NOV-1998) to the INSDC.
RL   Pathology, Univ. New Mexico, 915 Camino de Salud, NE, Albuquerque, NM
RL   87131, USA
XX
DR   MD5; 3cc6a2620af592e26ced8fd6e8e24de5.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:4566531, gi:4566532, gi:4566533, gi:4566534.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..819
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT   mRNA            join(<1..73,174..443,544..>819)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..>819)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TQI8"
FT                   /protein_id="AAD23391.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=3
XX
SQ   Sequence 819 BP; 121 A; 201 C; 217 G; 80 T; 200 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccacgagtcc       300
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagtgg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcgg                              819
//