Dbfetch

ID   AF097406; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   AF097406;
XX
DT   27-APR-1999 (Rel. 59, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA-020
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RX   DOI; 10.1007/s002510050536.
RX   PUBMED; 10380703.
RA   Fodil N., Pellet P., Laloux L., Hauptmann G., Theodorou I., Bahram S.;
RT   "MICA haplotypic diversity";
RL   Immunogenetics 49(6):557-560(1999).
XX
RN   [2]
RP   1-822
RA   Fodil N., Pellet P., Theodorou I., Bahram S.;
RT   ;
RL   Submitted (21-SEP-1998) to the INSDC.
RL   Centre de Recherche d'Immunologie et d'Hematologie, Faculte de Medecine, 4
RL   rue Kirschleger, Strasbourg 67085, France
XX
DR   MD5; 3341298cff2eeacf59268bd9abb39807.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AF097406.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="The sequence deposited represents exons 2, 3 and 4
FT                   of MICA gene encoding the extracellular alpha1, alpha2 and
FT                   alpha3 domains of the mature protein. The DNA source has
FT                   been derived from genomic DNA of a set of HLA Homozygous
FT                   Typing Cell Lines (HTCLs) provided by the 10th and 11th
FT                   International HLA workshop"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*009:02"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAD27009.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVS
FT                   LSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS"
XX
SQ   Sequence 822 BP; 215 A; 219 C; 233 G; 155 T; 0 other;
     gagccccaca gtcttcgtta taacctcacg gtgctgtcct gggatggatc tgtgcagtca        60
     gggtttcttg ctgaggtaca tctggatggt cagcccttcc tgcgctatga caggcagaaa       120
     tgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggaaataa gacatgggac       180
     agagagacca gggacttgac agggaacgga aaggacctca ggatgaccct ggctcatatc       240
     aaggaccaga aagaaggctt gcattccctc caggagatta gggtctgtga gatccatgaa       300
     gacaacagca ccaggagctc ccagcatttc tactatgatg gggagctctt cctctcccaa       360
     aacgtggaga ctgaggaatg gacagtgccc cagtcctcca gagctcagac cttggccatg       420
     aacgtcagga atttcttgaa ggaagatgcc atgaagacca agacacacta tcacgctatg       480
     catgcagact gcctgcagga actacggcga tatctagaat ccagcgtagt cctgaggaga       540
     acagtgcccc ccatggtgaa tgtcacccgc agcgaggcct cagagggcaa catcaccgtg       600
     acatgcaggg cttccagctt ctatccccgg aatatcacac tgacctggcg tcaggatggg       660
     gtatctttga gccacgacac ccagcagtgg ggggatgtcc tgcctgatgg gaatggaacc       720
     taccagacct gggtggccac caggatttgc caaggagagg agcagaggtt cacctgctac       780
     atggaacaca gcgggaatca cagcactcac cctgtgccct ct                          822
//