Dbfetch

ID   AF091305; SV 2; linear; genomic DNA; STD; HUM; 300 BP.
XX
AC   AF091305;
XX
DT   19-OCT-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*0602 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-300
RA   Bowman S., Diviney M., Dunckley H., Holdsworth R., Varney M.;
RT   "A new DQB1*0602 variant found in Australian Caucasian";
RL   Unpublished.
XX
RN   [2]
RP   1-300
RA   Bowman S., Diviney M., Dunckley H., Holdsworth R., Varney M.;
RT   ;
RL   Submitted (09-SEP-1998) to the INSDC.
RL   Tissue Typing, Australian Red Cross Blood Service, PO Box 354, South
RL   Melbourne, Vic 3205, Australia
XX
RN   [3]
RC   Sequence update by submitter
RP   1-300
RA   Bowman S., Diviney M., Dunckley H., Holdsworth R., Varney M.;
RT   ;
RL   Submitted (28-MAR-2001) to the INSDC.
RL   Tissue Typing, Australian Red Cross Blood Service, PO Box 354, South
RL   Melbourne, Vic 3205, Australia
XX
DR   MD5; 53221c17401a756a22a84174d982cf1f.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
CC   On Mar 28, 2001 this sequence version replaced gi:3766222.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..300
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /note="Caucasian isolate"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>300
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..>300
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT   CDS             <1..>300
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:19:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAC64403.2"
FT                   /translation="VFPAEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVG
FT                   VYRAVTPLGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRGERRPP"
XX
SQ   Sequence 300 BP; 60 A; 74 C; 110 G; 56 T; 0 other;
     gttttccccg cagaggattt cgtgttccag tttaagggca tgtgctactt caccaacggg        60
     acggagcgcg tgcgtcttgt gaccagatac atctataacc gagaggagta cgcgcgcttc       120
     gacagcgacg tgggggtgta tcgggcggtg acgccgctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggaagt cctggagggg acccgggcgg agttggacac ggtgtgcaga       240
     cacaactacg aggtggcgtt ccgcgggatc ttgcagagga gaggtgagcg tcgtccgcca       300
//