spacer

EBI Dbfetch

ID   AF089719; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   AF089719;
XX
DT   29-SEP-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 gene (HLA-DRB1*13 allele), exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RA   Jezek D.A., Wagenknecht D.R., Lower F.E., Pulliam J.F.;
RT   "Novel DRB1*13 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-249
RA   Jezek D.A., Wagenknecht D.R., Lower F.E., Pulliam J.F.;
RT   ;
RL   Submitted (01-SEP-1998) to the INSDC.
RL   Pathology, University of Kentucky Medical Center, 800 Rose Street,
RL   Lexington, KY 40536, USA
XX
DR   MD5; ea3e75862ca8b9460de5be0192ec193c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>249
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <1..>249
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>249
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:O77978"
FT                   /db_xref="IMGT/HLA:DRB1*13:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O77978"
FT                   /protein_id="AAC61746.1"
FT                   /translation="LEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEYRAVTE
FT                   LGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 249 BP; 56 A; 59 C; 89 G; 45 T; 0 other;
     ttggagtact ctacgtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg        60
     gacagatact tccataacca ggaggagaac gtgcgcttcg acagcgacgt gggggagtac       120
     cgggcggtga cggagctggg gcggcctgat gccgagtact ggaacagcca gaaggacatc       180
     ctggaagacg agcgggccgc ggtggacacc tactgcagac acaactacgg ggttggtgag       240
     agcttcaca                                                               249
//


spacer
spacer