spacer

EBI Dbfetch

ID   AH008147; SV 2; linear; genomic DNA; STD; HUM; 1257 BP.
XX
AC   AH008147; AF085055-AF085058;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA-DGAB
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1257
RX   DOI; 10.1007/s002510050537.
RX   PUBMED; 10380704.
RA   Visser C.J., Tilanus M.G., Tatari Z., van der Zwan A.W., Bakker R.,
RA   Rozemuller E.H., Schaeffer V., Tamouza R., Charron D.;
RT   "Sequencing-based typing of MICA reveals 33 alleles: a study on linkage
RT   with classical HLA genes";
RL   Immunogenetics 49(6):561-566(1999).
XX
RN   [2]
RP   1-1257
RA   Visser C.J.T.;
RT   ;
RL   Submitted (21-AUG-1998) to the INSDC.
RL   Department of Virology, Eijkman-Winkler Institute, University Hospital
RL   Utrecht, Heidelberglaan 100, Utrecht 3584 CX, The Netherlands
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH008147.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:5813972, gi:5813973, gi:5813974, gi:5813975, gi:5813976.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1257
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1257
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1257)
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1257)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAD52071.1"
FT                   /translation="PHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT                   /number=2
FT                   /note="2D"
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT                   /number=3
FT                   /note="3G"
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT                   /number=4
FT                   /note="4A"
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1257
FT                   /gene="MICA"
FT                   /allele="MICA-DGAB"
FT                   /number=5
FT                   /note="5B"
XX
SQ   Sequence 1257 BP; 242 A; 245 C; 266 G; 204 T; 300 other;
     agccccacag tcttccttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc cagcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcatact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc gaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct atttttgtta      1200
     ttattatttt ctatgtccgt tgttgtaaga agaaaacatc agctgcagag ggtccag         1257
//


spacer
spacer