spacer

EBI Dbfetch

ID   AH008144; SV 2; linear; genomic DNA; STD; HUM; 1269 BP.
XX
AC   AH008144; AF085043-AF085046;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA-BEBF
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1269
RX   DOI; 10.1007/s002510050537.
RX   PUBMED; 10380704.
RA   Visser C.J., Tilanus M.G., Tatari Z., van der Zwan A.W., Bakker R.,
RA   Rozemuller E.H., Schaeffer V., Tamouza R., Charron D.;
RT   "Sequencing-based typing of MICA reveals 33 alleles: a study on linkage
RT   with classical HLA genes";
RL   Immunogenetics 49(6):561-566(1999).
XX
RN   [2]
RP   1-1269
RA   Visser C.J.T.;
RT   ;
RL   Submitted (21-AUG-1998) to the INSDC.
RL   Department of Virology, Eijkman-Winkler Institute, University Hospital
RL   Utrecht, Heidelberglaan 100, Utrecht 3584 CX, The Netherlands
XX
DR   MD5; d616c5803a3b198f2e8fd4a251d2b2b3.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH008144.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:5813954, gi:5813955, gi:5813956, gi:5813957, gi:5813958.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1269
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1269
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1269)
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1269)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAD52068.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAAAAIFVIIIFYVCCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT                   /number=2
FT                   /note="2B"
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT                   /number=3
FT                   /note="3E"
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT                   /number=4
FT                   /note="4B"
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1269
FT                   /gene="MICA"
FT                   /allele="MICA-BEBF"
FT                   /number=5
FT                   /note="5F"
XX
SQ   Sequence 1269 BP; 242 A; 246 C; 273 G; 208 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acaatgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact       840
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct gctgctgctg      1200
     ctatttttgt tattattatt ttctacgtct gttgttgtaa gaagaaaaca tcagctgcag      1260
     agggtccag                                                              1269
//


spacer
spacer