spacer

EBI Dbfetch

ID   AF081676; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AF081676;
XX
DT   18-AUG-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 gene (DRB1*1126 variant allele),
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Hurley C.K., Tang T.F., Coquillard G.;
RT   "Human leukocyte Antigen Class II DRB1*1126 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Hurley C.K., Tang T.F., Coquillard G.;
RT   ;
RL   Submitted (03-AUG-1998) to the INSDC.
RL   Microbiology & Immunolgy, Georgetown University, 3970 Reservoir Rd. NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; 501f9514a20b4e03d9eaecd957e9e8ae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*0401,1126 variant; DRB3*0101;
FT                   DQA1*03XX,05AC; DQB1*03"
FT                   /tissue_type="whole blood"
FT                   /note="isolated from people of Italian and Spanish ethnic
FT                   background"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>269
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..269
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:O78161"
FT                   /db_xref="IMGT/HLA:DRB1*11:34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O78161"
FT                   /protein_id="AAC32201.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 269 BP; 57 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcga                                         269
//


spacer
spacer