spacer

EBI Dbfetch

ID   AH006330; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH006330; AF079413-AF079415;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related A KMCE protein (MICA) gene,
DE   MICA-KMCE allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1007/s002510050655.
RX   PUBMED; 10369917.
RA   Petersdorf E.W., Shuler K.B., Longton G.M., Spies T., Hansen J.A.;
RT   "Population study of allelic diversity in the human MHC class I-related
RT   MIC-A gene";
RL   Immunogenetics 49(7-8):605-612(1999).
XX
RN   [2]
RP   1-1022
RA   Petersdorf E.W., Shuler K.B., Longton G.M., Spies T., Hansen J.A.;
RT   ;
RL   Submitted (21-JUL-1998) to the INSDC.
RL   Human Immunogenetics, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N, Seattle, WA 98109, USA
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH006330.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:3377725, gi:3377726, gi:3377727, gi:3377728.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="MICA"
FT                   /allele="MICA-KMCE"
FT   mRNA            join(<1..255,356..643,744..>1022)
FT                   /gene="MICA"
FT                   /allele="MICA-KMCE"
FT                   /product="MHC class I chain-related A KMCE protein"
FT   CDS             join(<1..255,356..643,744..>1022)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA-KMCE"
FT                   /product="MHC class I chain-related A KMCE protein"
FT                   /note="alpha 1, 2, and 3 domains"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAC28941.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLREIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA-KMCE"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA-KMCE"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA-KMCE"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 213 A; 218 C; 236 G; 155 T; 200 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc gggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acaatgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact       840
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tg                                                                     1022
//


spacer
spacer