spacer

EBI Dbfetch

ID   AF076476; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AF076476;
XX
DT   28-JUL-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I antigen HLA-C gene (HLA-Cw*0403 variant allele),
DE   exons 2 and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RX   DOI; 10.1034/j.1399-0039.1999.530212.x.
RX   PUBMED; 10090622.
RA   Ren E.C., Haniff F., Loh M.T., Chan S.H., Petersdorf E., Hansen J.;
RT   "Identification of a novel HLA-C allele, Cw*0406, in a Singapore Malay";
RL   Tissue Antigens 53(2):198-200(1999).
XX
RN   [2]
RP   1-791
RA   Ren E.C., Haniff F., Loh M.T., Chan S.H.;
RT   ;
RL   Submitted (01-JUL-1998) to the INSDC.
RL   Department of Microbiology, W.H.O. Collaborating Center for Immunology,
RL   National University of Singapore, Lower Kent Ridge Rd, Singapore 119260,
RL   Singapore
XX
DR   MD5; 961ffa3bc5ca823c8c4b5059303519c0.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Singapore"
FT                   /cell_line="MP3"
FT                   /cell_type="B-LCL"
FT                   /note="Malay individual"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /number=2
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presentation"
FT                   /db_xref="GOA:P30504"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*04:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1IM9"
FT                   /db_xref="PDB:1QQD"
FT                   /protein_id="AAC27626.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            516..791
FT                   /gene="HLA-C"
FT                   /number=3
XX
SQ   Sequence 791 BP; 146 A; 258 C; 280 G; 107 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccg agtctccccg tctgagatcc       360
     accccgaggc tgcggaaccc gcccagaccc tcgaccggag agagccccag tcacctttac       420
     ccggtttcat tttcagttta ggccaaaatc cccgcgggtt ggtcgggact ggggcggggc       480
     tcgggggacc gggctgacca cgggggcggg gccagggtct cacaccctcc agaggatgtt       540
     tggctgcgac ctggggccgg acgggcgcct cctccgcggg tataaccagt tcgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga tctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer