Dbfetch

ID   AF074845; SV 1; linear; genomic DNA; STD; HUM; 258 BP.
XX
AC   AF074845;
XX
DT   23-JUN-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*8001 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RX   DOI; 10.1034/j.1399-0039.1999.530213.x.
RX   PUBMED; 10090623.
RA   Steiner L.L., Wu J., Noreen H.J., Moehlenkamp C., Cavalli A., Davidson M.,
RA   Johnson S., Winden T., Segall M., Begovich A.B., Williams T.M.;
RT   "Four new DP alleles identified in a study of 500 unrelated bone marrow
RT   donor-recipient pairs";
RL   Tissue Antigens 53(2):201-206(1999).
XX
RN   [2]
RP   1-258
RA   Steiner L., Begovich A.;
RT   ;
RL   Submitted (26-JUN-1998) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, Inc., 1145 Atlantic Avenue,
RL   Alameda, CA 94501, USA
XX
DR   MD5; f2d3e58dd179c15b2742a67f96aaf123.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            2..258
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT   mRNA            <2..>258
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <2..>258
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*80:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAD39682.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQ"
XX
SQ   Sequence 258 BP; 61 A; 62 C; 94 G; 41 T; 0 other;
     gagaattacc ttttccaggg acggcaggaa tgctacgcgt ttaatgggac acagcgcttc        60
     ctggagagat acatctacaa ccgggaggag ttcgtgcgct tcgacagcga cgtgggggag       120
     ttccgggcgg tgacggagct ggggcggcct gatgaggact actggaacag ccagaaggac       180
     atcctggagg agaagcgggc agtgccggac aggatgtgca gacacaacta cgagctgggc       240
     gggcccatga ccctgcag                                                     258
//