spacer

EBI Dbfetch

ID   AF056981; SV 1; linear; genomic DNA; STD; HUM; 947 BP.
XX
AC   AF056981;
XX
DT   17-NOV-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44032 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-947
RX   DOI; 10.1034/j.1399-0039.1999.530205.x.
RX   PUBMED; 10090615.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Granados J.,
RA   Varela P., Alegre R., Longas J., Gonzalez-Hevilla M., Martin-Villa J.M.,
RA   Arnaiz-Villena A.;
RT   "Evolutionary relationships between HLA-B alleles as indicated by an
RT   analysis of intron sequences";
RL   Tissue Antigens 53(2):153-160(1999).
XX
RN   [2]
RP   1-947
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (02-APR-1998) to the INSDC.
RL   Immunologia, Hospital 12 De Octubre, Carretera De Andalucia, Madrid, Spain,
RL   28041
XX
DR   MD5; 16a68feb11b1d3784860358c35d49810.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..947
FT                   /organism="Homo sapiens"
FT                   /isolate="21959"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..29,159..428,672..>947)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q9TPP7"
FT                   /db_xref="IMGT/HLA:B*44:03:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TPP7"
FT                   /protein_id="AAF08610.1"
FT                   /translation="ALALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRF
FT                   DSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHII
FT                   QRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAE
FT                   QLRAYLEGLCVESLRRYLENGKETLQRA"
FT   exon            <1..29
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            159..428
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            672..947
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 947 BP; 164 A; 310 C; 355 G; 118 T; 0 other;
     ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg gtcgggaggg aaatggcctc        60
     tgtggggagg agagagggga ccgcaggcgg gggcgcagga cccggggagc cgcgccggga       120
     ggagggtcgg gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaggtattt       180
     ctacaccgcc atgtcccggc ccggccgcgg ggagccccgc ttcatcaccg tgggctacgt       240
     ggacgacacg ctgttcgtga ggttcgacag cgacgccacg agtccgagga aggagccgcg       300
     ggcgccatgg atagagcagg aggggccgga gtattgggac cgggagacac agatctccaa       360
     gaccaacaca cagacttacc gagagaacct gcgcaccgcg ctccgctact acaaccagag       420
     cgaggccggt gagtgacccc ggcccggggc gcaggtcacg actccccatc ccccacgtac       480
     ggcccgggtc gccccgagtc tccgggtccg agatccgccc ccgaggccgc gggacccgcc       540
     cagaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt cagttgaggc       600
     caaaatcccc gcgggttggt cggggcgggg cggggctcgg gggacggggc tgaccgcggg       660
     gccggggcca gggtctcaca tcatccagag gatgtatggc tgcgacgtgg ggccggacgg       720
     gcgcctcctc cgcgggtatg accaggacgc ctacgacggc aaggattaca tcgccctgaa       780
     cgaggacctg agctcctgga ccgcggcgga caccgcggct cagatcaccc agcgcaagtg       840
     ggaggcggcc cgtgtggcgg agcagctgag agcctacctg gagggcctgt gcgtggagtc       900
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcgg                     947
//


spacer
spacer