spacer

EBI Dbfetch

ID   AF056483; SV 2; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AF056483; AF056484; AH006044;
XX
DT   23-APR-1998 (Rel. 55, Created)
DT   09-MAY-2010 (Rel. 104, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*0801 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Lazaro A.M., Hurley C.K.;
RT   "Novel HLA B allele";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Marcos C.Y., Lazaro A.M., Noreen H., Stastny P.;
RT   ;
RL   Submitted (30-MAR-1998) to the INSDC.
RL   Internal Medicine, UT Southwestern, 5323 Harry Hines Blvd., Dallas, TX
RL   75235-8886, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-791
RA   Lazaro A.M., Hurley C.K.;
RT   ;
RL   Submitted (04-MAY-2010) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; edf8aadc361d4b73b7680409de172445.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
CC   On or before May 4, 2010 this sequence version replaced gi:3063633,
CC   gi:3063634, gi:3063632.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30460"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*08:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AGB"
FT                   /db_xref="PDB:1AGC"
FT                   /db_xref="PDB:1AGD"
FT                   /db_xref="PDB:1AGE"
FT                   /db_xref="PDB:1AGF"
FT                   /db_xref="PDB:1M05"
FT                   /db_xref="PDB:1MI5"
FT                   /db_xref="PDB:3FFC"
FT                   /db_xref="PDB:3SJV"
FT                   /db_xref="PDB:3SKM"
FT                   /db_xref="PDB:3SKO"
FT                   /db_xref="PDB:3SPV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30460"
FT                   /protein_id="AAC14124.2"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 114 A; 174 C; 191 G; 67 T; 245 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agagcatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc ggagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggacacgct       780
     ggagcgcgcg g                                                            791
//


spacer
spacer