Dbfetch

ID   AF052574; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   AF052574;
XX
DT   18-MAR-1998 (Rel. 55, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 gene (HLA-DRB1*1424 allele),
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RA   Gaur L.K., Youngs D.A., Boyd C.S., Montero R.P., Nelson K.A.;
RT   "A Novel DR14 allele (DRB1*1424) is a DR14 recombinant with DRB1*15 alpha
RT   helix sequence";
RL   Tissue Antigens 0:0-0(1998).
XX
RN   [2]
RP   1-249
RA   Gaur L.K., Youngs D.A., Boyd C.S., Montero R.P., Nelson K.A.;
RT   ;
RL   Submitted (06-MAR-1998) to the INSDC.
RL   Molecular Biology, Puget Sound Blood Center, 921 Terry Avenue, Seattle, WA
RL   98104, USA
XX
DR   MD5; 28c4163e868d2ddb3e4d96579e1852c8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..249
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   gene            1..249
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1424"
FT   CDS             <1..>249
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:O62890"
FT                   /db_xref="IMGT/HLA:DRB1*14:24"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O62890"
FT                   /protein_id="AAC05839.1"
FT                   /translation="EYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTEL
FT                   GRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 249 BP; 54 A; 59 C; 92 G; 44 T; 0 other;
     gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggag        60
     agatacttcc ataaccagga ggagaacgtg cgcttcgaca gcgacgtggg ggagtaccgg       120
     gcggtgacgg agctggggcg gcctgatgcc gagtactgga acagccagaa ggacatcctg       180
     gagcaggcgc gggccgcggt ggacacctac tgcagacaca actacggggt tggtgagagc       240
     ttcacagtg                                                               249
//