spacer

EBI Dbfetch

ID   AH005655; SV 2; linear; genomic DNA; STD; HUM; 642 BP.
XX
AC   AH005655; AF030929-AF030930;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I HLA-A (HLA-A) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-642
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   "A24 alleles (A*2410)";
RL   Unpublished.
XX
RN   [2]
RP   1-642
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   ;
RL   Submitted (22-OCT-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:2642577, gi:2642578, gi:2642579.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..642
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="lymphoblastoid THA-DCH639"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>642
FT                   /gene="HLA-A"
FT   mRNA            join(<1..270,371..>642)
FT                   /gene="HLA-A"
FT                   /product="MHC class I HLA-A"
FT   CDS             join(<1..270,371..>642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I HLA-A"
FT                   /db_xref="GOA:O19612"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19612"
FT                   /protein_id="AAB87060.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQR"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..642
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 642 BP; 109 A; 163 C; 193 G; 77 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gc                          642
//


spacer
spacer