spacer

EBI Dbfetch

ID   AF030928; SV 1; linear; genomic DNA; STD; HUM; 272 BP.
XX
AC   AF030928;
XX
DT   27-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I HLA-A gene (HLA-A*2410 allele), exon 3, complete
DE   sequence; and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-272
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   "A24 alleles (A*2410)";
RL   Unpublished.
XX
RN   [2]
RP   1-272
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   ;
RL   Submitted (22-OCT-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
DR   MD5; 36e264d4178e61f32622ea82d7f63073.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..272
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="lymphoblastoid THA-DCH611"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(AF030927.1:<1..270,1..>272)
FT                   /gene="HLA-A"
FT                   /product="MHC class I HLA-A"
FT   gene            order(AF030927.1:<1..270,1..>272)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2410"
FT   CDS             join(AF030927.1:<1..270,1..>272)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I HLA-A"
FT                   /db_xref="GOA:O19611"
FT                   /db_xref="IMGT/HLA:A*24:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19611"
FT                   /protein_id="AAB87059.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQR"
FT   exon            1..272
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 272 BP; 54 A; 79 C; 98 G; 41 T; 0 other;
     gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gc                                     272
//


spacer
spacer