spacer

EBI Dbfetch

ID   AH005643; SV 2; linear; genomic DNA; STD; HUM; 642 BP.
XX
AC   AH005643; AF030897-AF030898;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I HLA-A (HLA-A) gene, HLA-A*1101 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-642
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   "A11 alleles (A*11O1)";
RL   Unpublished.
XX
RN   [2]
RP   1-642
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   ;
RL   Submitted (22-OCT-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:2642517, gi:2642518, gi:2642519.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..642
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="lymphoblastoid THA-DCH1093"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101"
FT   mRNA            join(<1..270,371..>642)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101"
FT                   /product="MHC class I HLA-A"
FT   CDS             join(<1..270,371..>642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101"
FT                   /product="MHC class I HLA-A"
FT                   /db_xref="GOA:O19600"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19600"
FT                   /protein_id="AAB87048.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQR"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101"
FT                   /number=3
XX
SQ   Sequence 642 BP; 109 A; 163 C; 196 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgcggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gc                          642
//


spacer
spacer