spacer

EBI Dbfetch

ID   AF029293; SV 1; linear; genomic DNA; STD; HUM; 221 BP.
XX
AC   AF029293;
XX
DT   26-APR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens DR01021 MHC class II antigen gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-221
RA   Arnaiz-Villena A.;
RT   "HLA class II polymorphism";
RL   Unpublished.
XX
RN   [2]
RP   1-221
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (08-OCT-1997) to the INSDC.
RL   Inmunologia, Hospital 12 de Octubre, Carretera de Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 9481a5c9766e262f2d3e3d5eea193630.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..221
FT                   /organism="Homo sapiens"
FT                   /isolate="2"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /clone="DR01021"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..221
FT                   /number=2
FT   mRNA            <1..>221
FT                   /product="MHC class II antigen"
FT   CDS             <1..>221
FT                   /codon_start=2
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="AAF65502.1"
FT                   /translation="ECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDA
FT                   EYWNSQKDLLEQRRAAVDTYCRHNYGAV"
XX
SQ   Sequence 221 BP; 48 A; 51 C; 84 G; 38 T; 0 other;
     tgaatgtcat ttcttcaatg ggacggagcg ggtgcggttg ctggaaagat gcatctataa        60
     ccaagaggag tccgtgcgct tcgacagcga cgtgggggag taccgggcgg tgacggagct       120
     ggggcggcct gatgccgagt actggaacag ccagaaggac ctcctggagc agaggcgggc       180
     cgcggtggac acctattgca gacacaacta cggggctgtg g                           221
//


spacer
spacer