spacer

EBI Dbfetch

ID   AF029290; SV 1; linear; genomic DNA; STD; HUM; 220 BP.
XX
AC   AF029290;
XX
DT   26-APR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens DR1503 MHC class II antigen gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-220
RA   Arnaiz-Villena A.;
RT   "HLA class II polymorphism";
RL   Unpublished.
XX
RN   [2]
RP   1-220
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (08-OCT-1997) to the INSDC.
RL   Inmunologia, Hospital 12 de Octubre, Carretera de Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 9331051b91e2eb4c38c490e9dfafa49c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..220
FT                   /organism="Homo sapiens"
FT                   /isolate="4"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /clone="DR1503"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..220
FT                   /number=2
FT   mRNA            <1..>220
FT                   /product="MHC class II antigen"
FT   CDS             <1..>220
FT                   /codon_start=1
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MXZ3"
FT                   /db_xref="IMGT/HLA:DRB1*15:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MXZ3"
FT                   /protein_id="AAF65499.1"
FT                   /translation="ECHFFNGTERVRFLDRHFYNQEESVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDILEQARAAVDTYCRHNYGVV"
XX
SQ   Sequence 220 BP; 44 A; 54 C; 84 G; 38 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagaca cttctataac        60
     caggaggagt ccgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg acgctgagta ctggaacagc cagaaggaca tcctggagca ggcgcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg                             220
//


spacer
spacer