spacer

EBI Dbfetch

ID   AF029272; SV 1; linear; genomic DNA; STD; HUM; 222 BP.
XX
AC   AF029272;
XX
DT   26-APR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens DR0406 MHC class II antigen gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-222
RA   Arnaiz-Villena A.;
RT   "HLA class II polymorphism";
RL   Unpublished.
XX
RN   [2]
RP   1-222
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (08-OCT-1997) to the INSDC.
RL   Inmunologia, Hospital 12 de Octubre, Carretera de Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 63ba78e3f502926f8a50814842b9ce1b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..222
FT                   /organism="Homo sapiens"
FT                   /isolate="14"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /clone="DR0406"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..222
FT                   /number=2
FT   mRNA            <1..>222
FT                   /product="MHC class II antigen"
FT   CDS             <1..>222
FT                   /codon_start=3
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MY10"
FT                   /db_xref="IMGT/HLA:DRB1*04:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY10"
FT                   /protein_id="AAF65482.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAVTELGRPDA
FT                   EYWNSQKDLLEQRRAEVDTYCRHNYGVV"
XX
SQ   Sequence 222 BP; 47 A; 54 C; 83 G; 38 T; 0 other;
     atgagtgtca tttcttcaac gggacggagc gggtgcggtt cctggacaga tacttctatc        60
     accaagagga gtccgtgcgc ttcgacagcg acgtggggga gtaccgggcg gtgacggagc       120
     tggggcggcc tgatgccgag tactggaaca gccagaagga cctcctggag cagaggcggg       180
     ccgaggtgga cacctactgc agacacaact acggggttgt gg                          222
//


spacer
spacer