spacer

EBI Dbfetch

ID   AF029265; SV 1; linear; genomic DNA; STD; HUM; 224 BP.
XX
AC   AF029265;
XX
DT   26-APR-2000 (Rel. 63, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens DR03011 MHC class II antigen gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-224
RA   Arnaiz-Villena A.;
RT   "HLA class II polymorphism";
RL   Unpublished.
XX
RN   [2]
RP   1-224
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (08-OCT-1997) to the INSDC.
RL   Inmunologia, Hospital 12 de Octubre, Carretera de Andalucia, Madrid 28041,
RL   Spain
XX
DR   MD5; 9200e9b48996af02937edf7259815f05.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..224
FT                   /organism="Homo sapiens"
FT                   /isolate="7"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /clone="DR03011"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..224
FT                   /number=2
FT   mRNA            <1..>224
FT                   /product="MHC class II antigen"
FT   CDS             <1..>224
FT                   /codon_start=2
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9MY17"
FT                   /db_xref="IMGT/HLA:DRB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY17"
FT                   /protein_id="AAF65475.1"
FT                   /translation="SECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPD
FT                   AEYWNSQKDLLEQKRGRVDNYCRHNYGVV"
XX
SQ   Sequence 224 BP; 49 A; 52 C; 85 G; 38 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg tacctggaca gatacttcca        60
     taaccaggag gagaacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgccg agtactggaa cagccagaag gacctcctgg agcagaagcg       180
     gggccgggtg gacaactact gcagacacaa ctacggggtt gtgg                        224
//


spacer
spacer