spacer

EBI Dbfetch

ID   AF028012; SV 1; linear; genomic DNA; STD; HUM; 253 BP.
XX
AC   AF028012;
XX
DT   08-JAN-1998 (Rel. 54, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen DR-beta 3 gene (HLA-DRB3*0303 allele),
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-253
RA   Panigoro R., Greville W.D., Dunckley H., van Eijck A.;
RT   ;
RL   Submitted (03-OCT-1997) to the INSDC.
RL   Molecular Genetics, Australian Red Cross Blood Sevice, 153 Clarence Street,
RL   Sydney, NSW 2000, Australia
XX
DR   MD5; e3555b07aaa99bfda78538c492509951.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..253
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..253
FT                   /gene="HLA-DRB3"
FT                   /number=2
FT   CDS             <1..>253
FT                   /codon_start=2
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen DR-beta 3"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*03:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAB94614.1"
FT                   /translation="FLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVT
FT                   ELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFT"
XX
SQ   Sequence 253 BP; 52 A; 58 C; 92 G; 51 T; 0 other;
     tttcttggag ctgcttaagt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggagaga tacttccata accaggagga gttcgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgtcgccgag tcctggaaca gccagaagga       180
     cctcctggag cagaagcggg gccgggtgga caattactgc agacacaact acggggttgg       240
     tgagagcttc aca                                                          253
//


spacer
spacer