spacer

EBI Dbfetch

ID   AF021225; SV 1; linear; mRNA; STD; HUM; 1082 BP.
XX
AC   AF021225;
XX
DT   13-JUL-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I chain-related protein B (MICB) mRNA, MICB-005
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1082
RX   DOI; 10.1111/j.1399-0039.1998.tb03008.x.
RX   PUBMED; 9694358.
RA   Visser C.J., Tilanus M.G., Schaeffer V., Tatari Z., Tamouza R., Janin A.,
RA   Charron D.;
RT   "Sequencing-based typing reveals six novel MHC class I chain-related gene B
RT   (MICB) alleles";
RL   Tissue Antigens 51(6):649-652(1998).
XX
RN   [2]
RP   1-1082
RA   Visser C.J.T.;
RT   ;
RL   Submitted (28-AUG-1997) to the INSDC.
RL   Immunology and Histocompatibility, St. Louis Hospital, 1, Av. Claude
RL   Vellefaux, Paris, CEDEX 10 75475, France
XX
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000252229; homo_sapiens.
DR   Ensembl-Tr; ENST00000383514; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000451603; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   H-InvDB; HIT000062567_04.4.
DR   H-InvDB; HIT000062567_05.4.
DR   H-InvDB; HIT000062567_06.4.
DR   H-InvDB; HIT000062567_07.4.
DR   H-InvDB; HIT000062567_08.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1082
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..1082
FT                   /gene="MICB"
FT                   /allele="MICB-005"
FT   CDS             <1..1082
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /product="MHC class I chain-related protein B"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="H-InvDB:HIT000062567_03.4"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*011"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="AAC39850.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKHQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQ
FT                   LGFQPLMSATGSTGSTEGT"
XX
SQ   Sequence 1082 BP; 271 A; 289 C; 305 G; 217 T; 0 other;
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       120
     gcagggcaaa gcaccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       180
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       240
     aggaccagaa aggaggcttg cattccctcc aggagattag ggtctgtgag atccatgaag       300
     acagcagcac caggggctcc cggcatttct actacgatgg ggagctcttc ctctcccaaa       360
     acctggagac tcaagaatcg acagtgcccc agtcctccag agctcagacc ttggctatga       420
     acgtcacaaa tttctggaag gaagatgcca tgaagaccaa gacacactat cgcgctatgc       480
     aggcagactg cctgcagaaa ctacagcgat atctgaaatc cggggtggcc atcaggagaa       540
     cagtgccccc catggtgaat gtcacctgca gcgaggtctc agagggcaac atcaccgtga       600
     catgcagggc ttccagcttc tatccccgga atatcacact gacctggcgt caggatgggg       660
     tatctttgag ccacaacacc cagcagtggg gggatgtcct gcctgatggg aatggaacct       720
     accagacctg ggtggccacc aggattcgcc aaggagagga gcagaggttc acctgctaca       780
     tggaacacag cgggaatcac ggcactcacc ctgtgccctc tgggaaggcg ctggtgcttc       840
     agagtcaacg gacagacttt ccatatgttt ctgctgctat gccatgtttt gttattatta       900
     ttattctctg tgtcccttgt tgcaagaaga aaacatcagc ggcagagggt ccagagcttg       960
     tgagcctgca ggtcctggat caacacccag ttgggacagg agaccacagg gatgcagcac      1020
     agctgggatt tcagcctctg atgtcagcta ctgggtccac tggttccact gagggcacct      1080
     ag                                                                     1082
//


spacer
spacer