spacer

EBI Dbfetch

ID   AF017329; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF017329;
XX
DT   20-SEP-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class I antigen HLA-B (B*48 allele) gene, exon 3, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Burdett L., Cao K., Zhang G., Fernandez-Vina M.;
RT   ;
RL   Submitted (07-AUG-1997) to the INSDC.
RL   Nat. Histocompatibility Lab, Am. Red Cross, 22 S. Greene St., box 173,
RL   Baltimore, MD 21201, USA
XX
DR   MD5; ee3f7852e4f8ec2170fe2af61617dcad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="0328"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:O19578"
FT                   /db_xref="IMGT/HLA:B*48:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19578"
FT                   /protein_id="AAB70295.1"
FT                   /translation="SHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 52 A; 87 C; 101 G; 36 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer