spacer

EBI Dbfetch

ID   AF017323; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF017323;
XX
DT   20-SEP-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cao K., Burdett L., Zhang G., Fernandez-Vina M.;
RT   ;
RL   Submitted (07-AUG-1997) to the INSDC.
RL   Nat. Histocompatibility Lab, Am Red Cross, box 173, 22 S. Greene St.,
RL   Baltimore, MD 21201, USA
XX
DR   MD5; cde945a79687dbc2558ffdaf35b2f521.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="rn126c"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:O19572"
FT                   /db_xref="IMGT/HLA:C*04:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19572"
FT                   /protein_id="AAB70289.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSED"
XX
SQ   Sequence 270 BP; 56 A; 80 C; 98 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer