Dbfetch

ID   AF017321; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF017321;
XX
DT   20-SEP-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Cao K., Burdett L., Zhang G., Fernandez-Vina M.;
RT   ;
RL   Submitted (07-AUG-1997) to the INSDC.
RL   Nat. Histocompatibility Lab, Am Red Cross, box 173, 22 S. Greene St.,
RL   Baltimore, MD 21201, USA
XX
DR   MD5; a131d41501bf6e742bba4b4c4ddb70ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="64b"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:O19570"
FT                   /db_xref="IMGT/HLA:B*82:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19570"
FT                   /protein_id="AAB70287.1"
FT                   /translation="SHTLQRMFGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQDRAYLEDLCVESLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 54 A; 87 C; 98 G; 37 T; 0 other;
     ggtctcacac cctccagagg atgtttggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcaggacaga gcctacctgg aggacctgtg cgtggagtcg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//