spacer

EBI Dbfetch

ID   AF016302; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF016302;
XX
DT   15-OCT-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I HLA-C antigen (Cw*03) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Burdett L., Zhang H., Hallenbach J., Klitz W., Cao K., Fernandez-Vina M.;
RT   ;
RL   Submitted (28-JUL-1997) to the INSDC.
RL   National Histocompatibility Lab, American Red Cross, 22 S. Greene St.,
RL   Baltimore, MD 21201, USA
XX
DR   MD5; 7656ac2e85e62e6672c8813119d115ad.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000437866; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
DR   Ensembl-Tr; ENST00000471639; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /strain="ZA016"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="Cw*03"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="Cw*03"
FT                   /product="MHC class I HLA-C antigen"
FT                   /db_xref="GOA:O19551"
FT                   /db_xref="IMGT/HLA:B*15:39:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19551"
FT                   /protein_id="AAB80722.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEA"
XX
SQ   Sequence 270 BP; 58 A; 88 C; 88 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer