spacer

EBI Dbfetch

ID   AF014788; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AF014788;
XX
DT   29-AUG-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen HLA-B gene (HLA-B*1525 allele), exon 3 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   "B15 alleles (B*1525)";
RL   Unpublished.
XX
RN   [2]
RP   1-267
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   ;
RL   Submitted (18-JUL-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
DR   MD5; 6e67a63399f2ce76919e4d67695e0abd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="Thai DCH3258"
FT                   /cell_type="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..267
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1525"
FT   exon            1..267
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="2"
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B"
FT                   /db_xref="GOA:O19542"
FT                   /db_xref="IMGT/HLA:B*15:25:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19542"
FT                   /protein_id="AAB67826.1"
FT                   /translation="SHIIQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETL"
XX
SQ   Sequence 267 BP; 52 A; 79 C; 99 G; 37 T; 0 other;
     ggtctcacat catccagagg atgtatggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgc                                           267
//


spacer
spacer