spacer

EBI Dbfetch

ID   AF014785; SV 1; linear; genomic DNA; STD; HUM; 250 BP.
XX
AC   AF014785;
XX
DT   29-AUG-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen HLA-B gene (HLA-B*1525 allele), exon 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-250
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   "B15 alleles (B*1525)";
RL   Unpublished.
XX
RN   [2]
RP   1-250
RA   Chandanayingyong D., Sirikong M., Luangtrakool K., Srinak D., Rungroung E.,
RA   Bejchandra S.;
RT   ;
RL   Submitted (18-JUL-1997) to the INSDC.
RL   Transfusion Medicine, Faculty of Medicine, Siriraj Hospital, Mahidol
RL   University, Prannok Road, Bangkok 10700, Thailand
XX
DR   MD5; cea15db53afda9b961c9459bca0702a8.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000437866; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
DR   Ensembl-Tr; ENST00000471639; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..250
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="Thai DCH1109"
FT                   /cell_type="lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..250
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1525"
FT   exon            1..250
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="2"
FT   CDS             <1..>250
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B"
FT                   /db_xref="GOA:O19539"
FT                   /db_xref="IMGT/HLA:B*15:25:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19539"
FT                   /protein_id="AAB67823.1"
FT                   /translation="FYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWI
FT                   EQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEA"
XX
SQ   Sequence 250 BP; 54 A; 81 C; 84 G; 31 T; 0 other;
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac        60
     gtggacgaca cccagttcgt gaggttcgac agcgacgccg cgagtccgag gatggcgccc       120
     cgggcgccat ggatagagca ggaggggccg gagtattggg accgggagac acagatctcc       180
     aagaccaaca cacagactta ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag       240
     agcgaggccg                                                              250
//


spacer
spacer