spacer

EBI Dbfetch

ID   AF012767; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   AF012767;
XX
DT   20-SEP-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens MHC class I antigen HLA-A heavy chain (allele A*3301) mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Javaux F., Mollet I., Gebuhrer L.;
RT   "A new HLA A*19 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Javaux F., Mollet I., Gebuhrer L.;
RT   ;
RL   Submitted (08-JUL-1997) to the INSDC.
RL   HLA Laboratory, ETS de Lyon, 1-3 Rue du Vercors, Lyon 69007, France
XX
DR   MD5; a19565546f91b3589fbc0f3d8ce40640.
XX
CC   Region: HLA A*19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen HLA-A heavy chain"
FT                   /db_xref="GOA:O19521"
FT                   /db_xref="IMGT/HLA:A*31:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19521"
FT                   /protein_id="AAB70188.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
XX
SQ   Sequence 546 BP; 110 A; 162 C; 197 G; 77 T; 0 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gttctcacac catccagatg atgtatggct       300
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca gcaggacgcc tacgacggca       360
     aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer