spacer

EBI Dbfetch

ID   AF012766; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   AF012766;
XX
DT   20-SEP-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens MHC class I antigen HLA-A heavy chain (allele A*0201) mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Javaux F., Mollet I., Gebuhrer L.;
RT   "A new HLA A*02 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Javaux F., Mollet I., Gebuhrer L.;
RT   ;
RL   Submitted (08-JUL-1997) to the INSDC.
RL   HLA Laboratory, ETS de Lyon, 1-3 Rue du Vercors, Lyon 69007, France
XX
DR   MD5; 7f35c5cc2fd4ded026f632dcc1034264.
DR   H-InvDB; HIT000062245_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen HLA-A heavy chain"
FT                   /db_xref="GOA:O19520"
FT                   /db_xref="H-InvDB:HIT000062245_02.4"
FT                   /db_xref="IMGT/HLA:A*02:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19520"
FT                   /protein_id="AAB70187.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRQVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
XX
SQ   Sequence 546 BP; 110 A; 162 C; 194 G; 80 T; 0 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggcaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac cgtccagagg atgtatggct       300
     gcgacgtggg gtcggactgg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca       360
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcagctc       420
     agaccaccaa gcacaagtgg gaggcggccc atgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer