spacer

EBI Dbfetch

ID   AH007185; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH007185; AF011886-AF011888;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA-AFC
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1007/s002510050537.
RX   PUBMED; 10380704.
RA   Visser C.J., Tilanus M.G., Tatari Z., van der Zwan A.W., Bakker R.,
RA   Rozemuller E.H., Schaeffer V., Tamouza R., Charron D.;
RT   "Sequencing-based typing of MICA reveals 33 alleles: a study on linkage
RT   with classical HLA genes";
RL   Immunogenetics 49(6):561-566(1999).
XX
RN   [2]
RP   1-1022
RA   Visser C.J.T.;
RT   ;
RL   Submitted (01-JUL-1997) to the INSDC.
RL   Immunology and Histocompatibility, St. Louis Hospital, 1, Avenue Claude
RL   Vellefaux, Paris 75475, France
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH007185.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:4102447, gi:4102448, gi:4102449, gi:4102450.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="10th IHC Workshop lymphocytic cell line"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="MICA"
FT                   /allele="MICA-AFC"
FT   mRNA            join(<1..255,356..643,744..>1022)
FT                   /gene="MICA"
FT                   /allele="MICA-AFC"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,356..643,744..>1022)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA-AFC"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAD01491.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA-AFC"
FT                   /number=2
FT                   /note="2A"
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA-AFC"
FT                   /number=3
FT                   /note="3F"
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA-AFC"
FT                   /number=4
FT                   /note="4C"
XX
SQ   Sequence 1022 BP; 215 A; 219 C; 233 G; 155 T; 200 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actatgatgg ggagctcttc ctctcccaaa acgtggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc cagcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcacact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tg                                                                     1022
//


spacer
spacer