spacer

EBI Dbfetch

ID   AF011786; SV 1; linear; genomic DNA; STD; HUM; 238 BP.
XX
AC   AF011786;
XX
DT   15-AUG-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen HLA-DR beta 1 chain (new DRB1*11 allele)
DE   gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-238
RX   DOI; 10.1111/j.1399-0039.1998.tb03064.x.
RX   PUBMED; 9820607.
RA   Loiseau P., Loste M.N., Lepage V., Schaeffer V., Lethielleux P.,
RA   Tilanus M., van Der Zwan A.W., Dubel L., Nigou M., Johanet C., Charron D.;
RT   "Description of a new DRB1*11 allele (DRB1*1132)";
RL   Tissue Antigens 52(4):402-404(1998).
XX
RN   [2]
RP   1-238
RA   Loiseau P., Loste M.N., Lepage V., Schaeffer V., Dubel L., Nigou M.,
RA   Johanet C., Charron D.;
RT   ;
RL   Submitted (30-JUN-1997) to the INSDC.
RL   Immunologie et Histocompatibilite, Hopital Saint-Louis, 1, avenue claude
RL   vellefaux, Paris 75010, France
XX
DR   MD5; 38f494f1c83037849e78d50af06ce9ba.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..238
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..238
FT                   /gene="HLA  DRB1"
FT                   /number=2
FT   CDS             <1..>238
FT                   /codon_start=1
FT                   /gene="HLA  DRB1"
FT                   /product="MHC class II antigen HLA-DR beta 1 chain"
FT                   /note="first domain of DR beta 1 chain."
FT                   /db_xref="GOA:O19518"
FT                   /db_xref="IMGT/HLA:DRB1*11:32"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19518"
FT                   /protein_id="AAB65751.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDE
FT                   EYWNSQKDFLEDRRAVVDTYCRHNYGVGESFTVQ"
XX
SQ   Sequence 238 BP; 53 A; 53 C; 88 G; 44 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgaggagta ctggaacagc cagaaggact tcctggaaga caggcgggcc       180
     gtggtggaca cctactgcag acacaactac ggggttggtg agagcttcac agtgcagc         238
//


spacer
spacer