Dbfetch

ID   AF010142; SV 1; linear; mRNA; STD; HUM; 285 BP.
XX
AC   AF010142;
XX
DT   29-OCT-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II HLA-DR beta 1 chain (HLA-DRB1*1503 allele) mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-285
RA   Daubenberger C.A., Siegler U., Pluschke G.;
RT   "Confirmation of HLA DRB1*1503 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-285
RA   Daubenberger C.A., Siegler U., Pluschke G.;
RT   ;
RL   Submitted (24-JUN-1997) to the INSDC.
RL   Medical Parasitology, Swiss Tropical Institute, Socinstrasse 57, Basel
RL   4002, Switzerland
XX
DR   MD5; 919e3657ca4c4084521269f2b83a146c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..285
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_type="peripheral blood leukocyte"
FT                   /db_xref="taxon:9606"
FT   exon            1..285
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>285
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="HLA-DR beta 1 chain"
FT                   /note="class II HLA histocompatibility antigen"
FT                   /db_xref="GOA:O19517"
FT                   /db_xref="IMGT/HLA:DRB1*15:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19517"
FT                   /protein_id="AAB81176.1"
FT                   /translation="GDTRPRFLWQPKRECHFFNGTERVRFLDRHFYNQEESVRFDSDVG
FT                   EFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRV"
XX
SQ   Sequence 285 BP; 58 A; 73 C; 106 G; 48 T; 0 other;
     ggggacaccc gaccacgttt cctgtggcag cctaagaggg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagacac ttctataacc aggaggagtc cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga cgctgagtac       180
     tggaacagcc agaaggacat cctggagcag gcgcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtc                       285
//